PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000254112
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 356aa    MW: 41421.9 Da    PI: 6.5071
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000254112genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.81.2e-5471361129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                    +ppGfrFhPtdeelv++yL+kk+++k++++ +v+++vd+yk+ePwdL+   k+ + +++ewyfFs++dkky+tg+r+nratk+g+Wkatg+dk+++
  MDP0000254112   7 VPPGFRFHPTDEELVDYYLRKKTASKPIDF-DVVRDVDLYKIEPWDLEDlcKIGSgDQNEWYFFSHKDKKYPTGHRSNRATKAGFWKATGRDKAIY 101
                    69****************************.99**************943466553556************************************* PP

            NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                    + ++ lvg++ktLvfykgrap+g+k+dW+mheyrle
  MDP0000254112 102 R-GKFLVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                    *.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.19E-565140IPR003441NAC domain
PROSITE profilePS5100554.2197152IPR003441NAC domain
PfamPF023653.4E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MDTLSHVPPG FRFHPTDEEL VDYYLRKKTA SKPIDFDVVR DVDLYKIEPW DLEDLCKIGS  60
GDQNEWYFFS HKDKKYPTGH RSNRATKAGF WKATGRDKAI YRGKFLVGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETSEN GTPQAMKRMG DYESPNCYDQ VPFXQQLDNS PRTSISHTYV  180
SSQYQQQLHY SQCKPELDLQ YNMPHHHHDS FLQLPQLESP KVPHQPAXPY GNYVIQSSTV  240
LTQEEQLHYF CQQNPFNSSA SSSGHXHYNN TDYLQAVDQV KDWQALDKYV ASQLSHDQQD  300
ASKEVTNYSN AEETFHVAEH INMLANEASR RPDYNNNGQE YYASTSTSSC QIDLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-45613514140Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008385273.10.0PREDICTED: NAC domain-containing protein 7-like
RefseqXP_008385274.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX21e-117NAC7_ARATH; NAC domain-containing protein 7
TrEMBLM5WRV61e-176M5WRV6_PRUPE; Uncharacterized protein
STRINGVIT_02s0154g00020.t011e-146(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-116NAC 007